I would like to claim the prize as an early Christmas gift pls

There you go: https://www.warzone.com/MultiPlayer?GameID=43108935

boo

why the boos bodsequencer? boaty did as requested.

curious about this... if I change back to just Mongoose, will I still be Mongoose #1?

and I've never changed names before. Can I revert using coins or only cash?

Edited 2025-12-26 16:11:19

You can revert using coins, and I'll send you the coins you need!

Goose, idk if you will retain Mongoose #1 but it is worth noting for the future.

dd did not want to join the SEQUENCER INVASION in case he lost dd #1.

im not sure if wz gives the first available tag or if its always numbering up, but its worth trying either way

I can confirm that reverting name does change the name #.

Mongoose #1 (from 2013) is now Mongoose #17.

I think I will at least try to see if Fizzer will change it.

Edit: Fizzer kindly replied, but said the system is automated and the only way to do it would be to get 16 other "Mongoose" players to change their name!

Edited 2026-01-04 18:28:18

https://www.warzone.com/Profile?u=Mongoose_1 is not found, so in theory it should still be available...

but idk if Fizzer is going to be dealing with tag request changes

ok ok, im joining

Very creative SEQUENCER name, welcome! ;)

After many days, the next-gen sequencing results are finally in, and the protein sequence (after signal peptide cleavage) is: GIVEMEMYCQINSPLEASECQNSEQENCER

Thank you for your service!

https://www.warzone.com/MultiPlayer?GameID=43346310